SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000015465 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000015465
Domain Number 1 Region: 6-588
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 2.62e-158
Family Prokaryotic type I DNA topoisomerase 0.0000225
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000015465
Domain Number - Region: 623-661
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000221
Family PhnA zinc-binding domain 0.092
Further Details:      
 
Domain Number - Region: 938-965
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0045
Family Retrovirus zinc finger-like domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000015465
Sequence length 966
Comment (Takifugu rubripes)
Sequence
RAQIKRVLCVAEKNDAAKGISDIMSNGRFRRREGMSKFNKIYEYEYHLFGQNVTVLMTSV
SGHLLGLEFKTPFQKWHSCSPVLLFDAEVEKYCPENMVQIKRTLEKEVKQCQLLIIWTDC
DREGENIGFEIIDVCKAVKPNIQVLRAKFSEITPNSIRRACDTLSEPDSKVSDAVDVRQE
LDLRIGASFTRFQTLRLQKIFPESLANQLISYGSCQFPTLGFVVERFKAIQSFIPETFYK
IKVLHEVEEDTVEFSWKRNRLFNHTACLVLYQICMEDPIATVTSVTSKPKSKWRPLPLDT
VEMEKLASRKLRISAKETMKIAEKLYTRGFISYPRTETNIFPPNLALGPLVEEQTQSSVW
GAFAQRVLEQPGGPNPRQGKKSDQAHPPIHPTKHSSSLQGNEGRLYEFIVRHFLACVSQD
ALGQETVVDVDIAQEKFSTSGLMITARNYLDVYPYDRWTTKLIPVYEQGSQFQPTAIEMV
DGQTSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKSRMYVGLTSDQRFLPGELGMGL
VEGYNSMGYEMSKPNLRAELEADLKLVSEGRKDKWSVLQHHIQKYKTVFIESVHKAKKLD
EALSPYLGAAQEIPEEQQQDMEIPLPIRKCPHCGRDMVLKKKREGNGKYLTCVGYPACKT
AVWFPDMVLEVSRDQSICPTCRPAPVHMLKLKFRRGSLPPMMPLEFVGCIGGCDETLREV
LDLKYLRAGGSGGSGGGRGDGPHPPAPPPPRAPSSNARPSLPPVPTVVPQPQPPPRALSV
SASSDSNTIVCNCGQQALLLTVRKDGPNQGRQFYKCNGGTCGFFLWADQPGQQGASQSWC
APLQVSQPPRTTVNSANAGQTMCHCNETAVTRTVQKDGPNKGRMFHTCGKSREQQCGFFQ
WADENTPPSARSGAFDGGYNGGGNGGRQARRITGAATADKPPAAKRPRTCGICHTPGHTR
ATCPQR
Download sequence
Identical sequences H2SSS8
31033.ENSTRUP00000015465 ENSTRUP00000015465 ENSTRUP00000015465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]