SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000017902 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000017902
Domain Number 1 Region: 132-172
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000773
Family Retrovirus zinc finger-like domains 0.001
Further Details:      
 
Domain Number 2 Region: 91-133
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000183
Family Retrovirus zinc finger-like domains 0.0012
Further Details:      
 
Domain Number 3 Region: 50-90
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000291
Family Retrovirus zinc finger-like domains 0.0012
Further Details:      
 
Domain Number 4 Region: 2-23
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000209
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000017902
Sequence length 176
Comment (Takifugu rubripes)
Sequence
GNNECFGCGRTGHWIKDCPKSSGPRGRGPRGRGRLTSFLLVSHDLCVVTEQFCYRCGEHG
HIARDCDQPEDSCYNCHKSGHISRDCKEPKREREHLCYNCGKAGHVARDCEHANEQKCYS
CGEFGHIQKLCDKVKCYRCGEIGHVAVQCSKASETNCYNCGKAGHVARDCTIEASA
Download sequence
Identical sequences H2SZR4
ENSTRUP00000017902 31033.ENSTRUP00000017902 ENSTRUP00000017902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]