SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000019899 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000019899
Domain Number 1 Region: 88-322
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.99e-54
Family Voltage-gated potassium channels 0.00078
Further Details:      
 
Domain Number 2 Region: 2-67
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000471
Family Tetramerization domain of potassium channels 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000019899
Sequence length 329
Comment (Takifugu rubripes)
Sequence
FDPVRREFYFDRDPDAFKCIIGVYYFDEIHIKRGLCPICFIQEMEFWKIDQNVLDECCKS
SLNLEVERCVTRSQRCQRFVWKLMEKPDSSSLARVIAITSFIAILVSAVVMCIGTIPELQ
VVDAEGKLVEHPDLEAIETACMLWFTAEYLLRLASSPNKLHFALSIMNIIDFMAIMPFYV
VLSLTYLGTTSMMELVNVQQAIQALRIMRIARIFKLARHSSGLQTLTYALKRSLKELGLL
LMYMGVGIFVFSALAYTMEQSHPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKCNA
AVSFLCGVIAIALPIHPIINNFVIFYNKQ
Download sequence
Identical sequences H2T5G0
ENSTRUP00000019899 ENSTRUP00000019899 31033.ENSTRUP00000019899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]