SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000020028 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000020028
Domain Number 1 Region: 219-244
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000611
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000020028
Sequence length 721
Comment (Takifugu rubripes)
Sequence
KMAEVDFGDSELFEQLGDSPPPVSQHIRFTDDEDDCDEIRQLRSRLEECEDCNQRLIEEN
IIHKCLKRKQSILTRPRLDSGIIVEDVNFDGPVLQILYANNVISKSCRQEIEDCICNVIA
KHHFPRKEMIKSSFHIKPQHSAFVLDEDPSSTCAVKSTTEAFKVVGSVSYFTTFCLDKLG
QPLLNENPQTTDGWDTPLYHQTFQQVIGAEGVELEMKDKRSKSVCFNCGLSGHQLRDCPK
PKNMAAINERRKEFNQNNNQVTLGNQRYHADEVEERFSKYRPGIISDELLSALGIDGHTI
PPLIYRMRRLGYPPGWLKEAEMENSGLTLYDGNVSNDGNITDHTSSQNISYDVSKLVDFP
GFNVPAPRGMRDEFLQYGSIPMQNSHMKQNFSAYLSNNFPEPGETCNKRPHENVSSPKPR
KKTRRSPNESSDMDIESGMGSPYYPGAPYANNFQFQPPLPPGSPCFSSPPPLPQGTPPAT
PTPPPLPKETPPVTPRNGSPALRGQNWKVVDEIEEKTEDELTLEELEEQQRMIWAALENA
DTTPSSDCETPVSPCVSTPVHVDTEMEDTEEVPVPTEPVEPCHKNTAEEQPEPQETTPQE
LRPAKGENDGPHSPIPVQAQEEAPRSPGQVVAEEDSPQSPDPVECQVRKPESSQEDPEEV
SDSSSQDVRKVKAVPHRSYFATGIVPFEDTPEYTEVAEATGTYLKIRDLLKSSPRSLGKK
K
Download sequence
Identical sequences H2T5T9
ENSTRUP00000020028 ENSTRUP00000020028 31033.ENSTRUP00000020028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]