SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000020936 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000020936
Domain Number 1 Region: 37-65
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000816
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000020936
Sequence length 170
Comment (Takifugu rubripes)
Sequence
MATPMHRIIARRQAWRFEIKQLCIFYFTIAFFILYREANKQNVRCQKCLEMGHWTYECTG
KRKYLYRPTRTAEMKKKLKENEAKVDSTTGYIFHSPPPRVLRSKDASDSSSGSDGSSSDS
SSDSSDSSSSSSDDSDSSSDSEDDSSSSSSSSSSSSSSSDSSDSGSSSDS
Download sequence
Identical sequences H2T8E6
ENSTRUP00000020936 31033.ENSTRUP00000020936 ENSTRUP00000020936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]