SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000021111 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000021111
Domain Number 1 Region: 32-101
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000171
Family Cold shock DNA-binding domain-like 0.00062
Further Details:      
 
Domain Number 2 Region: 124-169
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000602
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000021111
Sequence length 230
Comment (Takifugu rubripes)
Sequence
PVAGGPGKGGGENPATSAEREDQRRPQILSGSGFCKWFNVRMGFGFISMTNSEGSPVDPP
LDVFVHQSKLVMEGFRSLKEGEQVEFTYKKSSKGLESLRVTGPGGGPCAGSDRRPKGKIP
LQKRKPKGDRCYNCGGLDHHAKECGLPPQPKKCHYCQSITHMVAQCPHKALAPGSQDQPP
STSAFGPGTAPYLYSPEEEEHAGSSPLEGSSSSPEEPHTRGPRTQRWRKC
Download sequence
Identical sequences H2T8X1
ENSTRUP00000021111 31033.ENSTRUP00000021111 ENSTRUP00000021111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]