SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000021602 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000021602
Domain Number 1 Region: 437-665
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-34
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 2 Region: 1067-1225,1262-1339
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-31
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 3 Region: 1388-1600,1629-1654
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-30
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 4 Region: 2-153,200-270
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-29
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000021602
Sequence length 2245
Comment (Takifugu rubripes)
Sequence
MILATITANCVVLALEQHLPGEDKTPMAKRLEKTEPYFIGIFCFEAGIKLVALGFVFHKG
SYLRNGWNVMDFIVVLSGILATAGAHMNIPVDLRTLRAVRVLRPLKLVSGIPSLQIVLKS
IMKAMIPLLQIGLLLFFAILMFAIIGLEFYSGKLHQTCLPSDDIQDNETVDSSELAFACG
VRKCPEKYECRDTWIGPNDGITQFDNILFAVLTVFQCITMEGWTAVLYNTNDALGTTWNW
MYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQVERELNGYRAWID
RAAIDIATLPQSLAPVPVTVSRHPNPSSDCIFPTCCFTEEVMLAEENKNSGCKSLKAAGN
HSNSSNAGFTMLKRASKKTGARRGAPGNEKFTDTSTASMSRSRMNFRSGRRGPAAYLRRK
ERMLRISIRRMVKTDTFYLMVLSLVALNTICVAIVHHNQPGWLTIFLYYAEFVFLGLFLA
EMFLKIYGLGFRLYFHSSFNCFDCGVIVGSIFEVVWGFFRPGISFGISVLRALRLLRIFK
ITKYWASLRNLVVSLMSSMKSIISLLFLLFLFTVVFALLGMQLFGGRFIFEDYTPTNFDT
FPAAIMTVFQILTGEDWNEVMYDGIRSQGGVQYGMWSSIYFIVLTLFGNYTLLNVFLAIA
VDNLANAQELTKDEEEEEEFFNQRYARAKTDEFGPSSSSSQVSGRRRPYLYRKRAIHRGR
PTFPDEQEAPPDEPPLRGPSTFANRRERRRKVNMSVWEQRANQLRKRRQMASREELFASP
TEDTAETPSATHHATTLSPGASPAHLPESPMSVGMPLPEPPMSISIPIPEPPEAEPLVNL
GEEKSGVNHRTTGGGGRHRIARKFRPNQGPEEGARHRRHRHREARPEAKSLDFAQTPQEV
QQMRRSLSQEKRVLDEREEKEEREEREKLEGEEAQDDCGTCIANPYAEDGSAHDPSSQSI
PVEPALEATEFNMRALESESSKVSIKRHASNQEGGVAIEMTTQPLLELAPMSVNTNELEA
YDPEKEEDTEEEEPCTPPKRAAPAPDSMFIFKASNPIRRICHYIVTMRYFEMTILLVIVA
SSIALAAEDPVCTNSDRNKVLRYFDYVFTGVFTFEMIIKMIDQGLILHDGSYFRDMWNLL
DFIVVVGALIAFALTNNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNV
FNILIVYQLFMFIFAVIAVQLFKGKFFYCTDGSMKSEKECQGFYIDYTRDKKEVKRREWR
RHEFHYDNVGWALLTLFTISTGEGWPQVLQHSTDVTEEDMGPSRGNRMEMSAFYVVYFVV
FPFFFVNIFVALIIITFQEQGDKMIHECSLEKNERACIDFTISAKPMTRYMPQNRQTLQY
RLWHFVASPSFEYTVLVMIALNTVVLMMKYYSAPTAYDTVLKHLNTAFTVLFSLECILKI
LAFGLVNYFRDTWNIFDFITVLGSISEIIVDLQSVNTINMSFLKLFRTARLIKLLRQGYT
IRILLWTFVQSFKALPYVCLLIAMLFFIFAIIGMQSSEKGSHLREPACFLQVFGNIKLDD
ESHINQHNNFKTFFSALMLLFRSATGESWQEIMLSCLSGQECEPDPSIAPLTLSPDHEGG
CGTDFAYCYFVSFIFLSSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWGEYDR
LACGRIHYTAMYEMLTHMSPPLGLGKKCPAKIAYKRLVLMNMPVDEDMTVHFTSTLMSLI
RTALDIKIARGQPLFEMFVTGGEDRIGLDSELQKEISIIWPYLPQKTLDLLVPINKDTDM
TVGKIYASMMIMDYFKQSKAKKLRQQLEAQKSNLMFKRLDAAALPEDILSNTQTLSTMAH
TAGSALTRGGFVALSPISPQELFLQPISSDVDSGQEKNLARDFSSLYRSYESSLLKRNTL
HLGHPLMSLALVFYRASVSHHNSLLLGNRRRGLCLRASSLPRLAVETQTEVASGSMKRSV
STIADQRVNGLWEEEKSPERFYRPRHKSYKAAGNAKRQKISVSRVQSFVKEPNISRSEHW
QQGDRERGRSKERCHLLSPDGSRCNSEERSLQPSRSSSAERANPADKQGNSSDSPVPSTS
ESSTPSGRRPSSHTPTHSRPHISYSPLVCHTHPSLGEDEEEAQESVAAERETLRHPSPPR
RYPSEPFLASQEDDHSPDPSGPMETLTFEAAVACSLGRSNTISSARPRSRTGWQVPNGHF
RKRLAQTVSVAGCDTLSDTEEDDRC
Download sequence
Identical sequences H2TAB2
ENSTRUP00000021602 ENSTRUP00000021602 31033.ENSTRUP00000021602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]