SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000023758 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000023758
Domain Number 1 Region: 36-107
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000022
Family Cold shock DNA-binding domain-like 0.00063
Further Details:      
 
Domain Number 2 Region: 124-171
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000331
Family Retrovirus zinc finger-like domains 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000023758
Sequence length 199
Comment (Takifugu rubripes)
Sequence
SSSLLGLCWCGGCGGAVLRAPTRESEEEEAAALSRGSGVCKWFNMRMGFGFISMSSRDGT
PLDPNLDVFVHQSKLHMEGFRSLREGEALDFTFKKSTKGLEAIRVTGPDGAPCLGSKRRP
KNALKRRSKAEKCYNCGGAGHHAKECQLPPQPKKCHFCQSISHMVAGCPARAQQQQQQLQ
LQQELQQQQQQEVQQEVQG
Download sequence
Identical sequences H2TGG0
ENSTRUP00000023758 31033.ENSTRUP00000023758 ENSTRUP00000023758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]