SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000023794 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000023794
Domain Number 1 Region: 240-328
Classification Level Classification E-value
Superfamily RING/U-box 3.28e-21
Family RING finger domain, C3HC4 0.058
Further Details:      
 
Domain Number 2 Region: 150-176
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000663
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000023794
Sequence length 395
Comment (Takifugu rubripes)
Sequence
MSCVHYKFYSKLDYNTVTFDGLHITLSELKKQIMTRERLKATDCDLQITNAQTREEYTDE
KAHIPKHSSVIVRRIPIGGVKPAGRTFIVYVCLCIYTLIFLQTDSSPSMSLAQLAKTPNL
VDANASEEDKIKAMISQSIHDYDPIHYSKRGVGPPPAHYTCYRCGKAGHYIRQCPMLMVI
MFLLHLAVRISKGIPQSFMVKAEPGTKGAMLTSTGEYAIPAIDAEAYAQGKKERPPFVPQ
DQPSSEDDADPIPDELLCPICNDLMVDAVVIPCCGNSYCDDCIRTALLESEEHVCYTCKQ
SDVSPDNLIANKFLRQAVNNFKNETGYTKHARKLVQNSAPPPPRLQLLRHSRQQDPLVAN
ASTSAPSTTTQVQAPTPTPAPAPEPSPPTPPHVSA
Download sequence
Identical sequences H2TGJ6
31033.ENSTRUP00000023794 ENSTRUP00000023794 ENSTRUP00000023794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]