SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000029710 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000029710
Domain Number 1 Region: 190-437
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-49
Family Voltage-gated potassium channels 0.0017
Further Details:      
 
Domain Number 2 Region: 32-144
Classification Level Classification E-value
Superfamily POZ domain 4.71e-30
Family Tetramerization domain of potassium channels 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000029710
Sequence length 490
Comment (Takifugu rubripes)
Sequence
PETETVKGVHFQRAQHLRDHKASYVVDHTLQVLVNVGGNRYTFPWSTLEQFPQSRLGRLR
SCTTPEEIARLCDDYDETRREYFFDRNPTAFRVILNFLAAGKLRLLRELCAVSLHDELDY
WGVDPGHMERCCRRRMVARVEEKAEREWKEEEWRRKRAKLKKKTRVVEKGSRRMAWMLRE
VVENPQSGLAGKTFACLSVVMVLVTVISLCISTMPELREDSRGECSQKCYSMFVVESICV
AWFTLEFLLRFINAQNKLAFARGPLNIIDAIAILPYYVSLVVDVRDDLHDDVIMGTGRGY
LDKLSLILRLLRALRILYLMRLARHSLGLQTLGLTMQRSMREFGLLLLFVCVAVTLYSPL
VHLAENELAPYATTHSHHSFSSIPASYWWAIISMTTVGYGDMVPHSIPGQIVALTSILSG
ILIMAFPATSIFHTFSRSYQELKQDYERLWKEERDEEEENLLSLSAQEPTSTSRLQDNKP
AGLFSTWRAV
Download sequence
Identical sequences H2TYF1
31033.ENSTRUP00000029710 ENSTRUP00000029710 ENSTRUP00000029710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]