SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000032888 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000032888
Domain Number 1 Region: 870-1299
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.23e-141
Family Reverse transcriptase 0.0000353
Further Details:      
 
Domain Number 2 Region: 514-664
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.55e-39
Family Retroviral integrase, catalytic domain 0.0052
Further Details:      
 
Domain Number 3 Region: 62-153
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.11e-20
Family SCAN domain 0.0021
Further Details:      
 
Domain Number 4 Region: 185-216
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000262
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000032888
Sequence length 1314
Comment (Takifugu rubripes)
Sequence
EDLDTFFLLFERLAKARKWSDSEQTLLLQCVLTGKAQEAFSALSMADSENYNSVKIAVLK
AYELVPEAYRQKFRTSRKQDDKTYVEFVRELTTLFNRWRIASGVETFPQLCELLLLEQFK
FTLPERIATFLAEHKVKSASEAAVLADEYALTHKIRGNWSRRDMPSSTRQMDGLSLELEV
DLPKRGGSHEKQYQGKTCNYCLGQGHWKRECPVLKSNSRFYQGIRPAKPVALAVSVRAAG
FVSLVGSGKRVPVNILRDSGALDSFILESVLPFSSDSDTGSCVKVRGMGLNVLTVPLHKL
SLSSNLVQAGIHVILGNDLARTHVQGGALLIPEVVTRSDTVEPCSGEHTDSAVYPVGVVT
RAQSRSGSETEGKDKSVTRSELIQEQEEDSSLQEVFHQVRSEGELENTVQGYFLEEGLLL
RKWVPQGENFVGEPIFQVVVPIKFRNAVLQTAHNAGAGHLGVRKTYDKVLRYFYWPRLKR
DVSAYIKTCHICQITGKPNQSIKPSPLCPVQADSQPFERLLIDCVGPLPKSKAGSMYLLT
VMCLSTRYPAAYPLRNITTKSVVKALSQFISVFGIPKVIQSDQGTNFTSHMFAEILKQLH
VKHALSSLYHPQSQGAIERFHQTLKSLLRSYCSELDRDWEEGLPWLMMAAREVTQESTGF
SPNDLVFGHAVRGPLAVLHDDWKKTSPPTNLTDYVNGFRRRLYEVGKLAKANLEKSQRKM
KGLFDRRVEKRVFSPGDQVLALLPLVGSPFQGKFSGPYAVLRQISDQNYIIATPDRRKKS
QLCHVNLLKPYYALPSVPSGTLGERPVAVAASVGNSDPVSVLVGGEKEDVNVPDDSMLQG
RLRNSESLSKLDMLLDHLPESRRNQIIELIHSFPSLFSDTPSRTHLVEHDIDVGDAQPIR
QRFYRVSPKKREQLETEVRYMLEHDIAVPSSSSWASPCLLVVKPDNTFRPCTDFRKVNKI
TKPDSFPLPRMEDCVDQVGSAKFVSKFDLLKGYWQVPLSKRAQDVASFITSSGLYSYKLM
PFGLRNAPATFQRLMNTVVAGLDGCAVYLDDVVIYSDTWENHLQHIKALFDRLVWANLTI
NLAKCEVARATVTYLGKVVGQGHVRPVRAKVLAIDQFSPPTTKKELMRFLGMVGYYRAFC
RNFSTVVAPLTSLLSEKAKFEWSPLCQQAFEEVKLVISSAPVLAAPTMGEPFKLQVDASK
LGAGAVLLQVGEDEIDHPVSFFSRKFNSYQLNYSIVEKEALALIWALQDFEVYVGGGVEP
LVVYTDHNPLTFLHSLQNPNQRLMRWCLFLQPYNLDIRHIKGAENVLADALSRA
Download sequence
Identical sequences H2U7H2
ENSTRUP00000032888 ENSTRUP00000032888 31033.ENSTRUP00000032888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]