SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000033088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000033088
Domain Number 1 Region: 486-676
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-53
Family cAMP-binding domain 0.00000000807
Further Details:      
 
Domain Number 2 Region: 221-489
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-37
Family Voltage-gated potassium channels 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000033088
Sequence length 1149
Comment (Takifugu rubripes)
Sequence
MDRLHSSMRKRLYSLPQHIGHKASIMSEGEDADKDTRRKSIRMKPLPSPTSAGSCKGIGE
TKSGESGIMETDIGRPMKTSSNGDCRRFRGSLSSITSRHVHESDSAEERRLITEGDVTPS
EESPLGAIGDGPPEQGAQGAGGGGGTQKDSPDQQPGFVKLDGIDQILPDDERLYQAGFMH
RQFGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVG
NLIIIPVGITFFKDEHTPPWIVFNVVSDTFFLMDLVLNFRTGIVKEDNTEIILDPQQIKI
KYLRSWFVVDFISSIPVDYIFLIVETRIDSDFYKTARALRIVRFTKILSLLRLLRLSRLI
RYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPADCWVSKNK
MVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATA
LIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNE
PLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFI
QHGVVSVLTKGNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEE
YPMMRRAFETVALDRLDRIGKKNSILQHKVQHDLSSGVLNYQENEIIQQIVQHDRDMAHC
AHLMQNVPPQTPPSPTPVIWAPLIQAPLQAAAATTSVAIALTHHPHLPHTLFRPPVSVLG
SLKDPSSRMKKLHTFAPSPAPGSAGDSPASTPSKLHTGVDMPLLASFRAQHMPSGSAGGS
TGSGLSGGAGGVFGTTGWSSGGAVGGSHFGMGIGSRGSSSFAPSQVPHSQPSAKPPQVSP
LQQFAGGGRTTGDLSLLHSPPQGSPSTRRRFYSQQPAEGSPSSLSHFNLTGLSSGILPHQ
MSIERSALASLAQYGSTNASPCLTPVAPSPTIQSPVAGRTFHYSDPPSITGSNSSLPMPH
SSFPSQLPSQSPKTGRDSPLGRFSEDLKLLSSSHPSLPQEVVPALGHHAPCSSVETGYYP
SPFSSPTLVPKPCSPMPGRMTPPIQTSPGHRQQTQSPRVSPALPLQRGSSAYSTDLETQT
VRSKLPSNL
Download sequence
Identical sequences H2U822
ENSTRUP00000033088 ENSTRUP00000033088 31033.ENSTRUP00000033088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]