SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000035067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000035067
Domain Number 1 Region: 273-430,462-527
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000204
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 2 Region: 10-161
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000471
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000035067
Sequence length 527
Comment (Takifugu rubripes)
Sequence
LWVSVYLPVLIYVCIREFLCLSVLVYQAIRWTRVLRPLLLVNVTEGRQLRRAFRSIRNAL
PQIIYVFLLFLFSLLIFSLMALKLVGKRDLKTTGGAPYFSSYVDIIFDLYVLVTTANSPD
VMMPAYNASSWFALFFIIYILINTYIFMSVFLAVVYNNYKKYLKSPLQELFSERLFTGTF
TKSLSLLEGSTLFDPKILLGKPHTLMLWRSQSDSSHGCLIDREGSICAAGRPPEHRSHYT
QIKATPTALHIPHPLPVGPQPSDLSIGSTSTFVMVYDLIILVNAIFIGLDEDNPLIADSE
WMFLSLYLLEILLKLYVFEPRAFFSRHNLWNWFDTIIVFSALIATVVNSAVKSCEFLPIL
IGLYGSHQILDIVLILRVLRLVRVVDSVQRFRTIINAMIRVGPAILTFGQLILVVYYIFA
MVGMELFKGKIKYFGEGSDDPTKLFCGNVLLNGTSFAQLNYCKNNFNDILSSFILLVELT
VVNQWHVLLRSCELTKRGWSRIFFVVFHIIVVIIIINIFVAFVLEAF
Download sequence
Identical sequences H2UDP8
31033.ENSTRUP00000035067 ENSTRUP00000035067 ENSTRUP00000035067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]