SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000035474 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000035474
Domain Number 1 Region: 113-147
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000413
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000035474
Domain Number - Region: 92-199
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 0.000275
Family Nickel-iron hydrogenase, small subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000035474
Sequence length 232
Comment (Takifugu rubripes)
Sequence
SNMMSAIETGISAYRPAQLLNWVHMSLQDSQRGAFDAPRAEPDTPQLDANISKRSAADLS
SNYLNNFFHLKSEALNNNFFKSSSPYGSLNNIADGLSSLADHFSDLSLSPETRRPSKRPP
PNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMG
QECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCQKCQILGYCCRRAQ
Download sequence
Identical sequences H2UEV5
31033.ENSTRUP00000035474 ENSTRUP00000035474 ENSTRUP00000035474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]