SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000036608 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000036608
Domain Number 1 Region: 96-323
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.14e-41
Family Voltage-gated potassium channels 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000036608
Sequence length 700
Comment (Takifugu rubripes)
Sequence
MLGSPSNNGGIRMLAPPAPDDDRRVEFVALTAVHTERSEPSTPERGHPSHRTGLLGTPLP
GPPGPRANTSASSKRFRKLQNFLYNVLERPRGFAFIYHAFNFLLVFSCLVLSVFSTIHEH
QKFANQDSSSWWLLHEFVMIVVFGLEYFIRIWAAGCCCRYRGWQGRLRFARKPFCVIDLI
VFVPSLAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELIT
AWYIGFLVLIFASFFVYLVEKDVNTDFNTYADSLWWGTITLTTIGYGDKTPRTWQGRLLA
AGFALLGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDASHS
YLTATWYFYDSMLPSFRELTLLFSHLQRQRNKQLLPLHDTYAQIHAGRKQRYPRLRACAR
GSADCFVPSRGEGSKIGFRDRIRMNNSRSSQTIRSKASPLPPGSNVRRSPSQENVPDPTS
PGKVQKSWSFNDRTRFRTSLRLKPRPPADVEGVGEDSTEDKPYCDMAMEEVIPAVKTLIR
AVRILKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQTRVDQIIGRGAVQPD
KKARPEKGEKTPPELDSLDELSMMGRVVKVEKQVQSIENKLDLLLNLYSHCLKKGSSNYT
LSTLLDPDLTSDYHSPTDQRDLFPSANTLNISTSESGNLE
Download sequence
Identical sequences H2UI37
ENSTRUP00000036608 31033.ENSTRUP00000036608 ENSTRUP00000036608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]