SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000037209 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000037209
Domain Number 1 Region: 40-99
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000183
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000037209
Sequence length 137
Comment (Takifugu rubripes)
Sequence
MKAISPVRSFRKNNANFSEHSLGISRSKTPVDDPLSLLYNMNDCYSKLKELVPSIPQNKN
VSKMEILQHVIDYILDLQIALDSSVALNSRLHHPTRPGQTPSRTPLTTLNTDISILSLQS
PELPSELMTDDSRTLHR
Download sequence
Identical sequences H2UJT8
31033.ENSTRUP00000037209 ENSTRUP00000037209 XP_003962535.1.43653 ENSTRUP00000037209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]