SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000038104 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000038104
Domain Number 1 Region: 527-558,709-783
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000432
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000038104
Sequence length 812
Comment (Takifugu rubripes)
Sequence
MEIRQRSLKYMVEREVLDEQKLEEVSQRKTYSDTHRPIRERIKGSIKCTVPRLKKTVVSF
FPILYWLPKYSIWDYGMPDLISGISVGIMHLPQGMAYALLASLPPVIGLYTSLYPALIYI
FFGTSRHISIGTFTVLSIMVGSVTERLAPDENFFKTNGTNVTEVDTDARDSYRIQVAAAT
TVLGGLIQVVLGLVKFGFVGTYLSEPLVRAYTTAAAAHAVVAQLKYMFGVSPTRFSGPLA
LIYTLMDVCSQLPHTHLPTLVVSVVSMVLLIAMKELNSFLNPKLPVPIPGELITITVATL
ISSYTGLNSSYQISVVGDIPSGLSSPQVPNVSLFGEVISDAFALAIVGYAISISLGKTFA
LKHGYKVDSNQELVALGLSNTVGGFFQCYSVCPSMSRSLIQETTGGKTQMAGVTSALIVL
VTILKLGPLFQDLPKAVLSSIVFVNLKGMFKQHSDVVPLWRSSKIDLVVWIFTWVSTLLL
NMDLGLAASIIFALLTVIFRTQMPTYSVLGNIPGTELYLDIETHREAREIPGITIFRSSS
TVYFANAELYLEALKEKSGLDISKMIIYKRRQEAKQKRREKRAERRAKRQAKREERRVQR
AAKTQSGLMVFSVEEEVSHGGQWDGTCSDKEEQSWTKRENGTVFVIPTTPRTPEGQSRWE
YLKGGDQDCTSLGWMSELQDGDTTTLGSSTEDTLSHDLERVSLGSLGKWTWDIHSIIIDL
STANFIDTVAIKTMKNIFKDFREIDVDVYIAGCQAPVVDQLEFGNFFSESVTKKHLFATV
HDAVIYCLNHRGATSLPRYEPSAVSTASPASL
Download sequence
Identical sequences H2UMD3
31033.ENSTRUP00000038104 ENSTRUP00000038104 ENSTRUP00000038104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]