SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000039612 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31033.ENSTRUP00000039612
Domain Number - Region: 252-280
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000733
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000039612
Sequence length 957
Comment (Takifugu rubripes)
Sequence
MGVPAFFRWLSRKYPSIIVHCVEEKGKECNGVRIPVDTTRPNPNEVEFDNLYLDMNGIIH
PCTHPEDKAAPKNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQQRSRRFR
ASKEGAELVEDKKRIREEVIQRGGYLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIAD
RLNNNPGWRNVTVFLSDASVPGEGEHKIMDFIRRQRAQPNHDPNTHHCLCGADADLIMLG
LATHEPNFTIIREEFKPNKPRPCALCGQLGHDIKDCQGTAREKQGEHDEFADSMPVSEQE
FIFIRLCVLREYLARELTMASLPFPFDFERSVDDWVFMCFFVGNDFLPHLPSLEIREGAI
DRLVGIYKDVVHKTGGYLTENGYVKLERVELIMQAVGVAEDNIFKKRKEDDEGFKRRMRE
KKKRMKMEQRGPAYLTTGQFTPHALGGRNQPEAVQNARHQAYEMRKQSMERNNKSSACPD
NSTESRGAKRKAEDSDSEPEPEDNVRLWEEGWKQRYYKNKFDVDVMDEDFRKKVVQSYVE
GLCWVLRYYYQGCASWKWYFPFHYAPFASDFKDIKGMFTDFEKDTKPFQPLEQLMSVFPA
ASGNFLPETWRNLMSSPDSSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRAALAD
VYPDLTPEEVKRNSLGSDFIFLGKAHPLYDFIQELYRTEATEGTEIPADLCHGIQGTLNL
DDDPILPDKAVMSPIPTLRDITQNNSVGVKFLDPQYPDGFVFKATLLPRAKIPTNVLKPE
DFERGGHRGSWRPQLGFNPNRQQAHLDQSSFRALGHNLNTGQRGRGHFSSAPPPSSYHQG
NYRPPHGGRHQSFQPDPPVLPLCPETVWRQPTSLRQRQPVITAGFAPLSFSTKTTKMQPG
VSQRPRSQNSLLGAPPSFHQQPQFSRDDGRDGRGPPHQGYSSRGYPLPPPSRRYKWN
Download sequence
Identical sequences H2URN9
ENSTRUP00000039612 31033.ENSTRUP00000039612 ENSTRUP00000039612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]