SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000042929 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000042929
Domain Number 1 Region: 7-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-28
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 89-123
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000293
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000042929
Sequence length 216
Comment (Takifugu rubripes)
Sequence
MSGGLAPSKSTVYVSNLPFSLTNNDLHKLFTKYGKVVKVTIVKDKDTRRSKGVAFVLFLD
RESARNCVRAINNKQLFSRTVKASIAIDNGRATEFIRRRNYTDKSKCYECGDVGHLSYAC
PKNILGDRDPPKKKEKKKKKKGQQPDHVEEEEAESEEEGEDPTLDSLSQAIAFQQARMEE
EGKQKLQDVFPSTSSDSRKPRIKKSAYFSDEEELSD
Download sequence
Identical sequences H2V149
ENSTRUP00000042929 ENSTRUP00000042929 31033.ENSTRUP00000042929 XP_003972869.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]