SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000045109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31033.ENSTRUP00000045109
Domain Number - Region: 116-145
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0023
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000045109
Sequence length 447
Comment (Takifugu rubripes)
Sequence
MGKSFANFMCKKDFHPASKSNIKKVWIAEQKLTFEKTKQEDLMQAYLKEQDNYNNRLLMG
DDRVKNGLNFMYEAPPGASKGNKEEKNEEGKEEYKFEWQKGAPREKYAKDDMNIRDQPFG
IQVRNVRCIKCHKWGHVNTDRECPLYGLSGINASTVATDEAAGPSMHPSELMAEMRNSGF
ALKKCVLDRNAIVGDPSQEYVASEEEEDPEVEFLKSLTTKQKQKLLRKLDRLEKQKAKKK
KSKKQKKKNKRKHKKKPESSDSSTDSSSSSSSSSGAESDSDSEGHSKVKTQKRKKKKKEK
DSCRDNSSKTELQVKSHRASSRRSRSPKRAGEESRDHRQTGMERSRHRSPGEEIKAEGDK
ERRRQSSRDRERASSSKTTADRCRSSEAGREERGRGRRHSRDTERSRSHADGRKSRTADG
RSRSRERRNEREARGRKEQEQREEGEK
Download sequence
Identical sequences H2V7C0
ENSTRUP00000045109 31033.ENSTRUP00000045109 ENSTRUP00000045109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]