SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000045551 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000045551
Domain Number 1 Region: 107-172
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000227
Family RING finger domain, C3HC4 0.032
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000045551
Domain Number - Region: 11-34
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.014
Family Retrovirus zinc finger-like domains 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000045551
Sequence length 172
Comment (Takifugu rubripes)
Sequence
PVHKTKKYFGRSCPHRVCRDCGQPGRYVQQCPMMMVKGQSVNAPQKMEMYNGLPQSIKAE
EGAKGAMLASTVYKFPQVSVCGYRKGLKQNKKRPLFHPPIQPDFKVVSTVPVELMCVICT
RLMVDAVIVPCCGYSFCDNCIRTTLIESEEGMCVACQQAASPECIYPNLSLR
Download sequence
Identical sequences H2V8L2
ENSTRUP00000045551 31033.ENSTRUP00000045551 ENSTRUP00000045551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]