SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000047275 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000047275
Domain Number 1 Region: 31-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000121
Family Growth factor receptor domain 0.0042
Further Details:      
 
Domain Number 2 Region: 227-271
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000047275
Domain Number - Region: 103-168
Classification Level Classification E-value
Superfamily FnI-like domain 0.00638
Family Fibronectin type I module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000047275
Sequence length 380
Comment (Takifugu rubripes)
Sequence
AGDHLSKMLMITIAVLFLGSLNVVLSSSCPAMCECPLEMPKCAPGVSVVLDGCGCCKVCA
RQLNEDCSLTEPCDHTKGLECNFGASFAGASTRGICRAKSEGRPCEYNSRIYQNGESFQP
NCKHQCTCIDGAVGCVPLCPQELSLPNLGCANPRLVKVAGQCCEEWVCDDGKQTDILERI
FGKDMLTDELERDLTNKNELISIVNGGLKSLPAFRPQPEVQLFDNHKCIVQTTPWSQCSK
SCGTGISTRVTNHNSECKLVKETRICEVRPCTQSPYSSLKKGKKCSRTKKSSQPVKFTYA
GCSSLKKYRPKYCGACVDGRCCSPHVTRTIRVKFRCEDGETFNKNIMMIESCKCTYNCPH
VNEASYPFYRLSNDIHKFRD
Download sequence
Identical sequences H2VDI1
ENSTRUP00000047275 31033.ENSTRUP00000047275 ENSTRUP00000047275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]