SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 311402.Avi_2109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  311402.Avi_2109
Domain Number 1 Region: 137-421
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.4e-124
Family Enolase 0.0000000289
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.19e-55
Family Enolase N-terminal domain-like 0.00000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 311402.Avi_2109
Sequence length 424
Comment (Agrobacterium vitis S4)
Sequence
MTAITDIIAREILDSRGNPTVEVDVYLEDGSMGRAAVPSGASTGAHEAVELRDGGKRYLG
KGVEKAVEAVNSEIYDAIGGHDAENQIQIDTIMRELDGTPNKSRLGANAILGVSLAVAKA
AAEASGLPLYRYVGGPNARILPVPMMNIINGGAHADNPIDFQEFMIMPVGADNIRDAVRM
GSEVFHTLKKELSAQGFNTNVGDEGGFAPGLKSAPEALDFIMKSIEKAGYRPGEDMYLAL
DCASTEFFKDGKYVLEGEGRTLEPEAMAEYLAELAAKYPIISIEDGMGEDDWDGWKYLTD
KIGATTQLVGDDLFVTNSARLRDGIRMGVANSILVKVNQIGSLSETLDAVETAHKAAYTA
VMSHRSGETEDSIIADLSVATNCGQIKTGSLSRSDRLAKYNQLIRIEELLGPQAAYAGTS
ILKA
Download sequence
Identical sequences A0A202F595 B9JW75
311402.Avi_2109 gi|222148554|ref|YP_002549511.1| WP_015915924.1.42352 WP_015915924.1.54306 WP_015915924.1.66188 WP_015915924.1.73387 WP_015915924.1.78727 WP_015915924.1.99423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]