SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 311402.Avi_5890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  311402.Avi_5890
Domain Number 1 Region: 396-480
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000589
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 311402.Avi_5890
Sequence length 493
Comment (Agrobacterium vitis S4)
Sequence
MKKIERYQRDWFSNIRGDVLSGIVVALALIPEAIGFSVIAGVDPKIGLFASVIIACVSAF
CGGRPGMISAATAATAVLIGGLVKDHGIQYLFAATVLMGLLQILAGFLKLGRLMRFVSRS
VMTGFVNALAILIFMAQLPELLGRPPSTFVMIGVALAIIYLFPRLTKVVPSPLVAIAVLT
AATWWFGWDVRSVSDLGELPSSLPLFGWPQVPLTFETLQIIFPYSIALAAVGLLESLLTA
QIVDDMTDTQSNKSQECIGQGASNIASGLFGGMGGCAMIGQSVINVSSGGRGRLSTFVAG
AFLLVLLLVLDDILRVVPMAALVAIMIMVSIGTFSWRSILDLRRNPPSSSLVMLVTVVTV
VATHDLSKGVLAGVLLSGVFFAGKVARMVHVKAEDQEDGSRLYRVDGQIFFASADAFIAA
FDFDDDVKAITIDVTQAHFWDITAVGALDKIVLKFRAKGAEVDVKGMNIASAHMMDRFAV
HRDPQAVLYAGGH
Download sequence
Identical sequences B9K232
311402.Avi_5890 gi|222106855|ref|YP_002547646.1| WP_012654172.1.42352 WP_012654172.1.44083 WP_012654172.1.73387 WP_012654172.1.78727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]