SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 311403.Arad_14157 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  311403.Arad_14157
Domain Number 1 Region: 1-75,261-336,365-404
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.00000932
Family Actin/HSP70 0.039
Further Details:      
 
Weak hits

Sequence:  311403.Arad_14157
Domain Number - Region: 135-188
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0117
Family D-glucarate dehydratase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 311403.Arad_14157
Sequence length 678
Comment (Agrobacterium radiobacter K84)
Sequence
MLRIGVDIGGTFTDFCGWREGEDRIVTLKVPSTPPAFENGFREGFEKLLERLAPEPGEAA
FVMHGTTVSTNAVIERKGPKIAFFVTKGYRDLLELQRIGVRNPLNLFETRTRPLIDREMV
FEVEERLLRGGLVRTSIDEAAVEALARRAADAGAAGYAVALLHSYANPQHEQAVARAIRK
AVGEDAEVSLSSEIWPRIGEYERAIVSVLNAFVKRRMNEYIGAVETYVAERLPGSQLFVT
RSNGGAMAASEARNFPIHTLLSGPASGVTAVQYLGRALGEHNILTMDMGGTSTDISLVRD
GEALTSTSAEVGEFPVVMPVTSIEAIGAGGGSVVTIDGGVLRIGPRSAGSYPGPACFSRG
GTEPTLTDAFLLAGYLPEALLGGDMQLDRHAAERAMAPIAETLKTDVLSAAEMCVTVASS
NMVAGVLPYLARQGVDPEDLTVLVYGGAGAIQGPLLAAEIGVNRVLVPATPSVFCALGGL
VSDLSNDALETVHGLDIDGSLIAKKFQVLREQGAEWLSRQAPPERLVSKTFECWAEMRYV
GQSFQVDVRLPDTAIEAHDIAAMHAAFHQEHERIYSHADKAAPVEFVDLRMRVRGSMSIP
QPTTPETFGAGGALKTVRSMRFHNKLIPEVRVFDRASLTPNDAIQGPAVIEQRDATIVVP
PEFVARVGAFGAILMTRS
Download sequence
Identical sequences B9JPF1
WP_012654953.1.91008 gi|222109048|ref|YP_002551314.1|NC_011990 gi|222109048|ref|YP_002551314.1| 311403.Arad_14157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]