SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 311403.Arad_3826 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  311403.Arad_3826
Domain Number - Region: 97-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00484
Family NfeD domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 311403.Arad_3826
Sequence length 152
Comment (Agrobacterium radiobacter K84)
Sequence
MFDNLVVQLGPWSWWVLGLVLLAAELVLPGFFLIWVGLAGIIVGALSLLFWDSAFWVWQI
QWLIFAASAVIVTLLGRHYVYNNSQATDEPFLNQRSASLIGRTATLAEPIIEGRGRIRLE
DTYWIVAGPDLPAGTRVKVVASNGRDLTVEAA
Download sequence
Identical sequences B9JA68
311403.Arad_3826 WP_012652337.1.91008 gi|222087079|ref|YP_002545614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]