SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 311403.Arad_7436 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  311403.Arad_7436
Domain Number 1 Region: 34-160
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-17
Family cAMP-binding domain 0.017
Further Details:      
 
Domain Number 2 Region: 166-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000322
Family CAP C-terminal domain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 311403.Arad_7436
Sequence length 250
Comment (Agrobacterium radiobacter K84)
Sequence
MPHDLSLLGTKPRSLPLLTSPIARKLETHIALLPEDKAALASLEIRKRVFAKGSDITHEG
QSRQSAYILCAGWACSYKLMRNGTRQVINFHVPGDLIGIRRILLPNCDDSLCAITRVEVG
EINLEELAEAFHGNGHLAMSILWSTLRDEAILVQHLVDVGRRRPIDRVAHFFLELSSRLN
LVGLGTKTAYQCPLTQSLIADALGLTAVHFNRVLRQLRELNAMRFHEGWVELLDPKRLER
LADFDSSYLQ
Download sequence
Identical sequences B9JN08
gi|222081171|ref|YP_002540534.1| 311403.Arad_7436 WP_012649293.1.39766 WP_012649293.1.49937 WP_012649293.1.55147 WP_012649293.1.78634 WP_012649293.1.91008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]