SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 311424.DhcVS_1115 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  311424.DhcVS_1115
Domain Number 1 Region: 61-125
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000366
Family NfeD domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 311424.DhcVS_1115
Sequence length 126
Comment (Dehalococcoides VS)
Sequence
MNIRLVWTVFTTLLEGAGIALLGLWLLPKVDFHLPLWVVLLAEGMLLVLSVYFYHVGTVT
LDQKPCTGAETIIGSSAVVVENLNPWGMIRLDGELWEAVTSEASIPCGQEVVIIGRDKMR
LRVKPK
Download sequence
Identical sequences D2BIS9
311424.DhcVS_1115 WP_012882375.1.64064 gi|270308499|ref|YP_003330557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]