SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 311424.DhcVS_533 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  311424.DhcVS_533
Domain Number 1 Region: 140-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.83e-129
Family Enolase 0.000000032
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.37e-54
Family Enolase N-terminal domain-like 0.00000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 311424.DhcVS_533
Sequence length 428
Comment (Dehalococcoides VS)
Sequence
MSAVVKSIKAREILDSRGNPTVEADVVLSDGSFGRAVVPSGASTGSHEAVELRDGDKSRY
NGLGVQKAVTNVNTTIAKAISGFKASDQQRLDNLLIELDGTPNKAKLGANAMLATSLAVA
HAAAASCHMPLYRYLNNCDEYILPVPMFNILNGGKHASNSTDFQEFMVMPTGAKSFAEAL
RMGTEVYHSLKKVLKGMNQNTTVGDEGGFAPSLPTNKDAVEVILKAIEKAGYRPGEDIFI
ALDPASSELYHEGKYTLATENKTLSSAEMVDYWCGWVGKYPIISIEDGLFEDDWDGWKML
TKKIGSKVQLVGDDFYVTNIKRLERGIQEKASNSILIKLNQIGTLSETIAAIKMANNSAW
TAVVSHRSGETEDTTIADLAVAMNAGQIKTGAPCRAERTAKYNRLLRIEEELGGKAKYPG
KEAFFNLK
Download sequence
Identical sequences D2BH85
WP_012881849.1.64064 311424.DhcVS_533 gi|270307955|ref|YP_003330013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]