SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 312153.Pnuc_0947 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  312153.Pnuc_0947
Domain Number 1 Region: 140-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.92e-127
Family Enolase 0.00000000943
Further Details:      
 
Domain Number 2 Region: 4-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.43e-54
Family Enolase N-terminal domain-like 0.00000484
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 312153.Pnuc_0947
Sequence length 428
Comment (Polynucleobacter necessarius asymbioticus QLW P1DMWA 1)
Sequence
MSAIVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYL
GKGVLKAVQNINVEIAETILGLDASEQAFLDHTLIELDGTHNKARLGANATLAVSMAVAR
AAAEEAGLPLYRYFGGSGGMQLPVPMMNIVNGGAHANNSLDIQEFMVMPVGAENFRDALR
CGAEIFHELKKILAAQGMPTTVGDEGGFAPNFKSNHECLQIIMKAIEGAGYQAGEDVLLA
LDCAASEFYKDGKYHLSGEGLQLTSSEFSDYLGNLADQFPIVSIEDGMHESDWDGWADIT
QKLGKKIQLVGDDLFVTNTRILKEGIDKGIANSILIKINQIGTLTETFAAIEMAKRANYT
AVISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDVATYPGK
SVFYNLKR
Download sequence
Identical sequences A4SXE9
WP_011902788.1.22821 WP_011902788.1.27397 WP_011902788.1.31131 WP_011902788.1.54276 WP_011902788.1.58031 WP_011902788.1.63010 WP_011902788.1.78143 gi|145589130|ref|YP_001155727.1| 312153.Pnuc_0947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]