SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 312309.VF_A0167 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  312309.VF_A0167
Domain Number 1 Region: 88-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000222
Family NfeD domain-like 0.0065
Further Details:      
 
Weak hits

Sequence:  312309.VF_A0167
Domain Number - Region: 27-89
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00112
Family LacY-like proton/sugar symporter 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 312309.VF_A0167
Sequence length 150
Comment (Vibrio fischeri ES114)
Sequence
MEFFEQMNHWHWLTLGLLLLAGELLGTAGYFLWIGLSAVAVGALYAVIPLSWQMQWISFA
VFSLFTTWLWWRYQHKKDISSDAKRALNQKDKQLIGQTSRLEEDIHAGSCRIVLGDTTWS
AKSAVDIEKGTLVRVVSVDGIILTIEPVKK
Download sequence
Identical sequences Q5E159
312309.VF_A0167 gi|59713350|ref|YP_206125.1| WP_011263065.1.11820 WP_011263065.1.21836 WP_011263065.1.23113 WP_011263065.1.76652 WP_011263065.1.80135 YP_206125.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]