SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 312309.VF_A1020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  312309.VF_A1020
Domain Number 1 Region: 5-101
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.81e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 312309.VF_A1020
Sequence length 105
Comment (Vibrio fischeri ES114)
Sequence
MELHQFESNEDILVLSVQGDMDAIGCRDIQPSIDSVIEQEHHQVQIDLSHVAFLDSSGIG
AIVYLYKRLIEKDRTMQIKNAHGQPLELLKLLRIENAIPVNKTTH
Download sequence
Identical sequences Q5DYQ6
WP_011263829.1.100783 WP_011263829.1.11820 WP_011263829.1.21775 WP_011263829.1.21836 WP_011263829.1.34959 WP_011263829.1.76652 WP_011263829.1.80135 YP_206978.1.56684 312309.VF_A1020 gi|59714203|ref|YP_206978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]