SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE00017 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE00017
Domain Number 1 Region: 1132-1295,1324-1402
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.81e-38
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 676-906
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-36
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 129-289,389-456
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.24e-36
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 1462-1715
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.81e-35
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE00017
Sequence length 1860
Comment (Caenorhabditis remanei)
Sequence
MLRQPVPELRSFQSLSKYAGGPRSVLGRRTSAITVNRRQSQSIRRHEDVEALGSIEGSKE
TLQLSEHGRLASSSEASPSRWEGRQIEWGNEEQVEEESDLPYPGFAEPALRCFYQARPPR
KWALQMVMSPWFDRITMAVILINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAI
EMVIKIMALGFCGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAIRTVRVLRP
LRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPK
SISENQSALFNNVKLTRFYIPEDTSLEYICSQPDANGLHTCSNLPPYTVNGIKCNLTIDD
YDQVTNDTCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQ
DAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRETERMLQERKRLQNRDSISC
TGSEMGGASTKEEGGDTVYAAIVRFIGHTFRRTKRAAKKVLLNLNFIKLKIISIFQKYTA
YMEERAERKSTERMQRRKSKLDDMATLSRIEEKAEDEEDEATANVEIKEEPIEHNEQNGD
GVRIKRVKIEEEPRVKIGNGNSNGPHYKHTDDEDESEEEHSDDESYDGEKAEKKKSKSKI
RWFRDKVRKFVVCDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALE
MLLKIIASGFFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMP
ALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSILGMNLFGCKFCKVEEKFLGGLAKKCERK
NFDTLLWALITVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILV
EGFQESKEEEKRQLEEEARKQAVEEEHERKRELELIIAKTTSPAFNNGVPPAECTCQRPT
SPEDTSSPRLLTANYHASPERKHSVNLDAIIDKRLVPRNTITAFDRSPMSEGRDDSRLNR
HASLVLPVANGVPYRRQRVHSWSGLCHHFNPNCPVHGRRALIETYAREKFLEASQELKQA
LAEEERRNEAKQNTFVRKLLKKTCLHNRTEFSLFLMGPKNPLRIKCLQTTQKKWFDYTVL
FFIGINCITLAMERPSIPPDSFERRFLQVSGYIFTVIFTGEMMMKVIANGCFIGQAAYFK
DGWNILDGILVVISLINISFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVV
MTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKIDCLEDSRNK
WVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDIQPIENYNEWRMIYFISFL
LLVGFFVLNMFVGVVVENFHKCKEALEREMREKEKEKRLKRKLKRQKFEESMAGKRKKME
RNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNY
FFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIR
VMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLE
CSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVD
PILAPCFFVIFVLISQFVLVNVVVAVLMKHLEESNKRDAEGPAEPTGENIENEITKSDDD
EIAEEPEPLAIEGGDSKEDEVEEEDVETEPSTQIPDGHGGIKRLSMQVLEQELIEVERNM
EERYRRASECLGGELQPLNPGEIEDLDDPDFRPRSRSHRPRARTNSALSNKSRGSHKSAL
Download sequence
Identical sequences E3LCC0
31234.CRE00017 XP_003118070.1.11157 CRE00017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]