SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE00107 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE00107
Domain Number 1 Region: 973-1172
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.89e-66
Family Reverse transcriptase 0.00025
Further Details:      
 
Domain Number 2 Region: 1227-1384
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.22e-32
Family Retroviral integrase, catalytic domain 0.022
Further Details:      
 
Domain Number 3 Region: 713-815
Classification Level Classification E-value
Superfamily Acid proteases 0.00000259
Family Retroviral protease (retropepsin) 0.053
Further Details:      
 
Weak hits

Sequence:  31234.CRE00107
Domain Number - Region: 610-667
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00654
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE00107
Sequence length 1895
Comment (Caenorhabditis remanei)
Sequence
MTLPVEEPPEEVLTDPTADGQENGTEKVVVGNKEDKRVPEPMEVEENVSLSVMKKTREMF
LKLAKEDTGKMLKTYAKANASTHESIMKPFIDLIVSTFQTLDAKEEDCEELAKENKELEK
ENEEVINKNEILQGLLDEMQDRDLGGTSNSKQAQEYQMVSMLASEGINTLEDLEEVFGNT
EKLQKLIKMQNDVYQASQQKVQQMEAEIKKLKKALKDSESRVKSYKGTQAEKEEQTRFIE
LNQKSNSFSRIGECTSCMSLKEMNSQIKENASQPTKSTGTTTLTSGMPQKVQKRTVQEQT
HTDKELEEVIEAARGQMDSESDSERADETIGNGRYYTNWDTGKQKEMSPVEMMNKMLVQQ
NLPEPPKFSAEENSIKLESFRKSFALKFESFSDENQIILLETKYLSGRALRIFRGLPEHE
KKSINGVMQAMAIRLRISPEDETRRAKSRWESLRKKPEQNIEDFCLSIDELARVAFKRVN
ASELSSFKTAKLLDAIAENETLSCLIDNRLLGMPERDHYDTCRMLATRYEQGIRDRNLRN
KSQNSEKKKSPSPQSSNTSSANNTSVQSNPNGQRTNTYSQNRNNFTNKTDNAGSPINQNW
RQRTGENSDNNGKTKGFIECSECKLVGCHDPKCSKAPGNAKTYSRPVVTCYRCQEQGHIA
TYCTKQSQNKVNDNPVKENTVNSVEDKQVLTIPSDAPKTEGNTMEKPLIKVEKGRIGNTE
VDLMLDSGACISIIPQKIWKKIVGENGEEWVKKVKEEKPELAQVFTANNQPLKLLCTVEV
ETSMQTRTRLIKYYIAAIDRENIILGMDQFNKLGVEVRIEEQPRAVKICKDIRLTPSSSR
VVQVSVEGVVQEGKDHCLITPIQECIAPSVCQVEANGRALVTISNFGTKPVLLRKGQTIA
LGEVDGFEVMQGKAENLEFLNEHLEETGFLNESAEIVCSVVQNEPDDKRWKTLCEHLKRQ
ESSSESETEVWNVIQSFQNIFAIEDSELGRTNATTCEIELLDGAEPIRQKPRPIPLAIRP
EIKKILQKMVMQGVIRISKSPWSSPVVIVKKKDGSVRMCVDYRKVNKVVKNNAHPLPHIE
ATLQSLSGKRIFTTLDLLAGYWQIPLDEKSKEITAFAIGSELYEYNVLPFGLVTSPAVFQ
ATMEAVVGDLLGKTAYVYVDDLLIAKAHAGTVAGHFGIEKIMRQLSKKFYWPKMRVIIEK
VVKGCPKCLCVNDHPKLVAPLKPYETSAPLEIVACDLIDVGLSTQGNRYILAIIDLFTKY
ASAIPIPDKKGETVVKAFVDRWAMGEGRIPNKLLTDMGKEFDNEHFKQLTKLLKIEHVMT
KGYNSRANGAVERFNKTLMHIMSKKAAVPIEWDDQIAFAVYAYNSVAHSTTGESPMYLMS
GRDSKGPLDLAGEDAVGMSYANLDEYKHLMASELAKAHALVREHAMQEQEQYKYLFDKKH
NTEKRKYPGPGSRVLVEIPSEKLGARCPKLVNKWKGPYRVIACSETSATVVPVLGKGKEV
LKIPFDHLRVIPAEMENVPIETVKSRAKMRVDSVHYDNMQNTQVNLITFSDIYGCRCPTS
CVFYPKDAMSARTTSPTQLQRMIALTKEAPDLLLRDNARELLLAIQTPIPGLNSTPDAET
FLALSNCPTVALVVKDLRGWEHEYLKFRHSLLEQFLGSGFERKETIQVILAPGVTREQIP
LQNMHITALTTESILEDDVHEQCAKHSTSIVVVVVPVSKKDTDLDTWRSIVNAIPTKSVV
YVIPTHMSDFDHSVMAVFINLFDRIKRDHGEIVHVSPEEIVEDKQHRMLYLASEIMKAPE
YWLAVKEMLEKKNRPWPQFQLASITKSNENTPQKTVSTELQPSSSTAPTATRTEGWDRGW
PPMRGHGNGRGSHRGRRQHNNGHHPYRRDGTSSRN
Download sequence
Identical sequences E3LD67
XP_003117592.1.11157 CRE00107 31234.CRE00107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]