SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE01068 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE01068
Domain Number - Region: 516-571
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000558
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE01068
Sequence length 624
Comment (Caenorhabditis remanei)
Sequence
MTEDTLFIEQYRGHANKLIKESNGCCNENEVVLANPTKDRKQRSLFERRQSLVDKKKALF
ILQGETSVQEESTRLEMVAHLKSQGFQETTERVQRIIEKINEKLTQEKAQQDQLQKERSL
SVIPSDAAIGKSGIVSNPAPQSHAPAGGVNSVAQINAIEHGNKEMRQHHANYSTNVPIAR
TVRKECWNPSYSDESRGRRDPSFQNQGYPETTTTRGGGDSLQVANQNFRDKQQRRRGSDD
CFNQGGKHSKEQFYPRIETSVQRYYMPQQERQVSMEELKCRIAKAQMNATIIQSLMATLK
PFDGQPHEFQAFMAQFDSMVHENKYIDAKMKQTILFKLLTEEVARLHNPTEYSPKRYWIL
REGLIKQFGNPDRQMFELLKQIHFTPFPSNDLAQLINHLHMTRVYARKLMMFGVNPSDPS
FQFIFAYKLPQQFKEQAFELMARRIHTFDELVQKTLETVEFKLRMEENQMEKSHTDTILH
RKSNNIQENQVSGRSSSSCLSPAQRLQQPEAHRTSTFTPPSRTKPCGYCDDKGHAAVDCS
SSLKKKLEAVTRKALCSNCLSKSHGVFTCQSRFNCSSCHKRHFTGHCPDSSKDGRIVATN
SDASDDKGNRDQLSRKEKDENPKL
Download sequence
Identical sequences E3MI45
CRE01068 31234.CRE01068 XP_003104115.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]