SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE01412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE01412
Domain Number 1 Region: 300-399
Classification Level Classification E-value
Superfamily Acid proteases 0.0000179
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Weak hits

Sequence:  31234.CRE01412
Domain Number - Region: 240-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000272
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE01412
Sequence length 666
Comment (Caenorhabditis remanei)
Sequence
MSFSTERTKKRSSSVTSFEKSWAVQMNEVSLRERRKLVKGFTDFVEASGQMESDIFEAVK
MTCQGTARQLEGLIAPVKKYGKELRERFDELGGERWTLEIIGLMRENGVETVEELRELCE
KGVKMVPGGIVENANKAQDELALLQDAWNEERETLFRELNKLKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKQENEPKKAGQARDTQEVPVPSRLEVVRKWSPKDSDDEFSMHGRR
GDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVKNAGVETVEMVEML
GQRRRVVIDSGAVVSVISTTAYERLKAGCRDWEKEVEVFGKPTFTVLNASNSKMRVRGQI
KIPMVVRGRKVRVVFQLVDNWVERILIGTNAFESIGVELKWKDPYGLVNAEENSAEVQFI
GGEKKLERPGEKLRKVPTEVSEIQCKSVAVRGERGRRASTGDVGEVFKSEGEEKERKKVK
IRASVAVIGPRLEARGPGVLEYRNKTITGWTQKFDWGEVKEAVVLVEYTDKEDENSKRVE
FVKSVAKEVEKVWMMPRSLQCELGDVDKVAKQWKEWLKTSANVEVVDPLMPVGNHKTPLI
LEKWHRKSLDGLQKYLHNALPSHSVRCQWEKNKYLGKGCPIAERRGKWLRRSSTFSKPHG
ITVKGN
Download sequence
Identical sequences E3NJ68
CRE01412 31234.CRE01412 XP_003091558.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]