SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE01450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE01450
Domain Number 1 Region: 714-1150
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.45e-25
Family Reverse transcriptase 0.017
Further Details:      
 
Domain Number 2 Region: 1454-1619
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.44e-20
Family Retroviral integrase, catalytic domain 0.02
Further Details:      
 
Weak hits

Sequence:  31234.CRE01450
Domain Number - Region: 350-383
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00872
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 
Domain Number - Region: 308-342
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0502
Family Retrovirus zinc finger-like domains 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE01450
Sequence length 1974
Comment (Caenorhabditis remanei)
Sequence
MKIVIERFEESREECDGMDVEFAAPSQKLIDVETTKDLEEKFHITANRIEEEGTEYVKKK
VGSALISNKTLPVPEFDGEPENWAEFYDIFKPIVEDNTELLDIVKFALLKKACRGKAGDM
IRIFTSADCFKEAIERLKKNYENKDNRFLMLWDKLEELRPARENVESMRRTINEVAAIVA
ALRKVSETETMAMKVLIKRKFPRRIHEELSRDANCDTTGKILEKIEDTINREERIEKDMI
GHKKLEGDRRNSYRRSNSREYNNYRRSNSREYNNYRTPEYKGNNRHRSSDSYTSQKSDKS
EKSTNSYRKSPFPRSRSRERKPCLFCNRSDHSTIDCRKVSNPEDRREFFRNHQRCYNCGR
NDHSVKECTSGRCRNCDRKHHTALCDREGNRVRFERNRSRSKSEERYVSNKRGYGKDSSY
SRVNTVVSSETRLMVTTGRVITTKSTHGEKFRPKAETMVILDTGADTNYITEQLAEYIGA
RVIDKNKDMRIKMVNNKENKITSNKVRFELMTQNGNIVVEALTIPSITTDFMPAPIEPEE
WEYLKKRDIPYKEPSKTDAGLLIGVDLFWRLMNNFENLILPTGRIVVNTKLGNVICGSII
DTQNTGTDKEESNNFMTRKSGIIENPVEKIPGRLEITHTLEDLFQLQNIGITDNPVDPKI
EEIKQMFYDTVRQDEGGRVETTFPFKKGMIPVLADNFRMALARLVSMYKQSRNTKAWEKL
VQNFEDMIKRGIIEDTKPVAIDEPDRPVYFIPYQLVYNENSNTTKVRTVFDASSAVRGEI
SLNKAIHQGPSLIPQLLGILIRIRTRKYVLSGDIEKAFHMVGLQEKHRDCTRFLWLKDPQ
GEVIDKNLRFMRFTRIPFGVNASPYLLAMAIEYAIQHSMASEKLKTAVKDMCYVDNLFGT
SNKAEELIELYKESKEVFNAIGMNIREFSLNSELENLIDPKDKTETGDNTKLLGYMFNGK
TDIMKVKKPKFSLIPDKGVTKREVVKIVSSIYDPLQLFAPIYLDGKRLIREVSGKDIKWE
DKIKEETRKLLEEYVSKIEKCEFTFKRWLEIPDKQPCTLAIFSDASKDVYGACAYLVWDP
SPLEKNKENRAILITAKQRLASKGHTITIPRLELVGIVLAARIATYLVKELDVNITTIAL
YSDSQIALNQIKSFNKDSTFVENRINEIWKHLEKLKTDENDTVIREVYLTHVPTNDNTAD
LITRGIETEELLKETNWFKGPQCIRRKEEANTENRIYERVNKNPKMPYNHQRESYITLVS
KVKNVDHPPDCSIIQDKHRQHWDRSCRIMVYILRFITRIRIRDRTHTGIISNYEFSIIEL
QKYNPNVKSEELECAEKVLIKEHQTNFNIKPMENLNQYLNPATKVVEQRYRVTSMEPKPV
IHTRSILATSIIDKIHSENLHCGVNTVLGIIREKYAGKKWRSAIKNRLTKCIRCRKVNNH
PYPKPKAGNLPERRITKDRAFQHIGIDYAGPFIVKAPGGRGYTAHKSWIAVITCMTSRLV
HLELVYSLTTDEFLLALARFMGRRGIPDSISTDNATTFQAAANIATSAYSVENYLANKRI
KWYFNTALAPWEGGVWERMVGLVKKALKHGLGDQCYSRKDLETIIIECESIINHRPLTYI
ADEESEIIRPIDLIQPKISYPIYNEKLLENEYREYTYRFREVINSVKRFWEVFNRDYQNQ
NKIFESVTFPNKAHCNTVQPVVGEIVMIKDEQLPRGKWQLGRITKLCPGKDEIVRAVEIK
TKTRNKIKRRIEHVIPLEIRPNSETQQVYEEKEKPQQKEKERKDQKVSEKPSRRITRSQT
RKEKEKQASIMSIRTQMKPTILYYLTIILYLATSVYAANKNPSLSELSIGTFQEAKEEMT
IVQENVATTTYSPNSVRNENRITTLTPLILTTTPKTTYPVTTPRSIDTTKPMYTTKKPKI
STTSQPKQQTTTTPKPRTDHGKQTKTPLEPLYGVQTLWCSMKSSIWCLAGFGGK
Download sequence
Identical sequences E3NN73
CRE01450 31234.CRE01450 XP_003090148.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]