SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE01522 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE01522
Domain Number 1 Region: 305-701
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.98e-105
Family Reverse transcriptase 0.00021
Further Details:      
 
Domain Number 2 Region: 182-272
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000311
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 3 Region: 112-152
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000628
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE01522
Sequence length 712
Comment (Caenorhabditis remanei)
Sequence
MFHDPLEYSNRISEAVLDSKLATMSTDDWSVFLFLRGLDGPGDAAAKAFLMQWAEQCERK
KEKVTLALIHDEWLRFLQLKQQTKTVAASSPKQPLSVNKVEKKPVRNTSNHKTETKGHGS
ESQSKKEFTCFKCGEQGHCAPQCPQNSGKKKTVKRWVKKGAKKTQSVRVDNLDGNQSKSV
KPSMWVNVGSQMLKFQLDTGSEITLISEKSWKAIGAPELEEVPHRIACANGTEMIVKGRV
LVSFELKGVQYSEYAYVRQEFTNLIGMSWLAHSPEVREALDVVVSTVTTAVAEKDSNQLR
MSLQTEFPKVFEDTLGLCTKEKAQVRTLPNVKPTFKKSRPVPYGSEKPVEAELKRLENMG
VIERISHSDWASPTVVVRKKDSGKLKGKIFSQIDLKDAYLQIELDPEAQKLAVINTHLGL
FKYKRMPFGLKPAPAIFQKVVDKLTNGLPGVASYLDDIIVSAETMHEHEHILKLLFARLE
EYGLKVSLEKCAFAKSEIKFLGFIVNGNGRKPDPQKTEVIRGMESPKNQKQLASFLGAIC
FYSRFVPKLSDLRGPLDRLMKQDVDWKWTNIEQNAFDRLKNSVADATMLSHFKEDWKIVI
AADASQYGIGGVLSHINPEGQEVPIAHFARSLTETEKRYSQIEKEGLALVYTVKKCHKFV
FGRKFSLQTDHKPLLAIFGDNKDLPVHSQNRLVRWAITLLFVQLQHKLCVDG
Download sequence
Identical sequences E3NWL4
31234.CRE01522 CRE01522 XP_003087207.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]