SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE01901 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE01901
Domain Number 1 Region: 137-239
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 5.75e-26
Family Elongation factor TFIIS domain 2 0.008
Further Details:      
 
Domain Number 2 Region: 261-306
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.7e-17
Family Transcriptional factor domain 0.00049
Further Details:      
 
Domain Number 3 Region: 10-93
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3.27e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE01901
Sequence length 308
Comment (Caenorhabditis remanei)
Sequence
MAGLESAQALCKRVDDICKNGMGSKDECIKLLDDLAKFQMTVEIIQQTSIGIKVNMMRKK
VPDESLAKRTKNIIKEWKNIVDSKSKSQDDSDAPAPKKQRKESVEEPKVEKKKIEAPYKR
QESNNRPEIVAQFASASFPPKHLENDETRLKSAQLLLSALRFGEMPQGTLDPEELAVQIE
EKLYSVHRDTNKNYSAAVRSRIFNLRDKKNLALRENVLTGVVRAEKFATMTSEEMASPEI
RNMRDKFTKEAILEHQMSVQQGTPSDMFKCGKCGKKNCTYTQLQTRSSDEPMTTFVFCLE
CGNRWKFC
Download sequence
Identical sequences E3LG68
CRE01901 XP_003117277.1.11157 31234.CRE01901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]