SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE01966 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE01966
Domain Number 1 Region: 172-259
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-27
Family Canonical RBD 0.00052
Further Details:      
 
Weak hits

Sequence:  31234.CRE01966
Domain Number - Region: 116-143
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00243
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE01966
Sequence length 261
Comment (Caenorhabditis remanei)
Sequence
MTGLNSITSAPEVVSWAEAVEQDNAPHIQEDADGTRTETAITEVDGVRYKIVTKFKVINK
RVPHVVAARKQWVKFGSCKGEPPGPQVATTYVAEEVEMQFTRNRAGEQILDVQEDKQTAK
TTSREHCRHCKGNDHWSTHCPYKVMYQLDEENDANQDADSSRNPLGRQDGRQIDRNRSDE
NTCRVTNLPQEMNEDELRDVFGRIGRVIRIFIARDKITGLPKGFAFVTFESRDDAARAIA
ELNDIRMYHMVLKVEWTRPST
Download sequence
Identical sequences A0A261C2S7
31234.CRE01966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]