SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE02519 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE02519
Domain Number 1 Region: 512-618
Classification Level Classification E-value
Superfamily Acid proteases 0.00000105
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Domain Number 2 Region: 470-495
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000366
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE02519
Sequence length 844
Comment (Caenorhabditis remanei)
Sequence
MSDKTSSKQSTLKLDDDRMIVVETQMSVKERRKKVKKFTKLIASSVKVEDETRLQLGELA
AKCSEREADAILEPMRIFNRELLEKFEEIGGDEWPRSVIRVMREFKLESVEELREACAKA
AESEEAEWSVGKVNLELQKVQYEKNLLTECWNEEKEMLGEQIQKIQKEKEVAEIQVSKLE
KALKQLRKTHELEERKPKGLWDEVQGSRSWYEKVVNWDSESTNKGSRKKGGEDAFSRKTL
SRSGSSEVNEMVQCMNRMLKSSALPEPKTFDGTGEFKEFKRAFLLKYNHVTESDDELVAI
LEEKFLKGAAKSLFKTLPKRYERSIQSLFEEFEHKLRKRQGDSKIEALNEFEGLEKRSDQ
KMWEYLVEVEKWSRMAFPEVKQETLSQMRTTKLMKAARADETLHKMLIMKRFELSLEEQY
EHLKDIVLQQGNEQRRGNCQKNRYSEGWKERPKAENDGEKDVAEKESGENRYWMEQKCFS
CGGVGHLARQCPSKPVQSVEVRGKGEGVGKVAVETVKLLGQERRMVVDSGAAVSVMSTGA
WNGLKEGCRNWMEMVKRLGKPSFEVIDTSKKKMRIIQQIEVPIQVRDRKAEVVFQLVEND
AEIMLLGTNAFKSIGVSLEWKQERTDVQQKKGKRGGTSSEEKKVFMVGNLGISVGNTDPY
KKTTEKNKEIAVVTVTEEKKEGMKPKKTVIRESKILIAPRIGVKGKSIFEYRKSALDTWK
NRFDFANVESIVFLLELTEDEETNQKLGDLVRKLAEEVKEITIIPYKMDGAKSGLVESWK
RSWITAGHVKWSDSAASADEKFKTWEQLLEFLEARTTENVVVAQLRKESVTSEPRIKEDK
WSHQ
Download sequence
Identical sequences E3MWP6
CRE02519 XP_003099409.1.11157 31234.CRE02519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]