SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE02565 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE02565
Domain Number 1 Region: 511-618
Classification Level Classification E-value
Superfamily Acid proteases 0.000000844
Family Retroviral protease (retropepsin) 0.019
Further Details:      
 
Domain Number 2 Region: 471-494
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000105
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE02565
Sequence length 871
Comment (Caenorhabditis remanei)
Sequence
MSDKTSSKQSTLKIDDDRMIVVETQMSVKERRKKVKKFTKLIASSVKVEDETRLQLGELT
TKCSEQEADAILEPMRIFHRELLEKFEEIGGDEWPRSVIRVMREFKLESVEELREACAKA
AESEEAEWSVGKVNLELQKVQYEKNLLTECWNEEKEMLGEQIRKIQREKEVAEAQVSRLE
KALKQLMKTVERQERKPNGLWDETQGNRSWCERVENWDIERNDEGNRKKGGEDAFRRKTL
SRSGSSEVNEMVQCMNRMLKSSALPEPKTFDGTGEFKEFKRAFLLKYNHVTESDDELVAI
LEEKFLKGAAKSLFKTLPKRYERSIQSLFEEFEHKLRKRQGDSKIEALNEFEGLEKRSDQ
KMWEYLVEVEKWSRMAFPEVKQETLSQMRTTKLMKAARADETLHKMLIMKRFELSLEEQY
DHLKDIVLQQENEQRRGNCQKGRYSEGWRERPKAENDGEKDVAEKESGENRYWMEQRCFS
CGGVGHLARQCPPKPVQSVEVRGKGEGAGKVAVETVKLLGQERRMVIDSGAAVSVMSTGA
WDGLKRNCRNWMEVVKRLGKPSFEVIDTSKKKMRIIQQIEVPIQVRDRKAEVVFQLVEND
AEIMLLGTNAFKSIGVSLEWKQERMDVQQKKGKRDATSSEEKKVFMVGNLGIRVENTKPS
GKTAEKSKEIALDTVTEEKKEGMKPKKTVIRESKILITPRIGVKGKSIFEYRKSALNTWK
NRFGFANVESIVFLLELTEDEETNQKLGDLVRKLAEEGKEITIIPYKMDCAKSGLVKSWI
TADNVKWSDSAASAGEKFKTWEQLLEFLEARTTENMVVAQLRKESVTSEPRKKENKWSHD
FQEGLEQRRFHHIFQLRHQFHTVSFREYFDL
Download sequence
Identical sequences E3N4U6
CRE02565 31234.CRE02565 XP_003096561.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]