SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE02692 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE02692
Domain Number 1 Region: 60-93
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000147
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE02692
Sequence length 101
Comment (Caenorhabditis remanei)
Sequence
MKMHVKLSKPKTPQDALETALSVEGVMTIPKHTDVLSNPRVLAATAGKVTNRDNSLRESD
DVRRSSVSSQQCYYCQEEGHYAWQCPEKTRRHHHPGSSRAQ
Download sequence
Identical sequences E3NJX8
XP_003091293.1.11157 CRE02692 31234.CRE02692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]