SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE02995 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE02995
Domain Number 1 Region: 638-670
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000279
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  31234.CRE02995
Domain Number - Region: 712-818
Classification Level Classification E-value
Superfamily Acid proteases 0.000146
Family Retroviral protease (retropepsin) 0.025
Further Details:      
 
Domain Number - Region: 171-227
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0864
Family Spectrin repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE02995
Sequence length 1256
Comment (Caenorhabditis remanei)
Sequence
MADIEEEEANRVAEEGRIRQEEANRLAEEERIRRENELLAEEPMDEGDEDKRVQEVRLAE
IEKVINETCIDIKNQTKFSTKQCRVLLSPLIGKILEVEEEFRGKKKESEFWENTNVKLNK
TVLSLQDELERKSPPQPSTPLEEPPTTSVLSGQSTQGNEERWKLVSLLEVNEIHNEEALN
ELFGKIEQLGNELSTHKELLQKAREQADRLREECFEAKQQIVLLQLKLKAEEEKSEKLKK
ENDTVAANNQSNNLTRYGEQRQSITEKNNNIMQTTGRHSMFATSTPQHGMHRQGEANGKV
GESRENARFYNADTSEIIDTITRQESRDSGGNWNQRIVEQDAQRSMIVHDGHEMPNMNMQ
WRMTQALPDPPVFSAGKNSVNAETFERAFYMKYRFFDIEAQKSFLETRFLAGNALTVYKG
LPESDKYSVSRILDAIKRRLSQSEPEESRRAKSKFQGLKLQKEQSIQSFCLQMDEIVRVG
YKGVPEHQISSMKTTKLLDEMKEHSIFDVSLQILGSQLRKCPEMEQYELCREEATRFDEE
WRSGKAKLNEKKVNRQQSNQNFSNQQSNYSNQNTSYSRNKQTVGNDETSQNWRERSQGKF
VPTNNAGGNNVVNKSVGFSECSECRLTGCHDPKCSRAPGSSTPRKSNPVVCFRCNEQGHI
APNCPQKSAQQLNSQGDMAKVQTLDKKECLEMPEAEKSKQNKNSRTPVRIEQGRIGSAEV
NFVIDSGACISVISENTWKEVVEKNGGKEWEKEAILKNPEKIDVYAANNTPMNLLYQVKV
ETSLHSRTRDLKFYVTDIDRDTVILGIDQFELLGIQMSFQKKPRDIRMVRQVKILPGSEK
IVEVSVEGTIRKDKSLCLITPMVSCLAPAIYQIRKSGKARVQMRTCPEEQQEYKVLFDAK
HRISQKSYPQPGARVLVEIPSEKMGARYPKLTNKWKGPYRVISCTENSATIVPVAGSNQE
TLKIPFDNLRNIPQQMDNTPVTTKKGRARLRNTAVEEITEKLVTDYDHDICIFSELYWCR
CQRPCLFAIPGQKDVRLHSPTQVVRAVQLLQKNKEMTRADVMMLAQKRLPMLSEIPTPEA
WHILSQCPTLSLWVKDIISWKEAFELQYAMTLEKWLGPELLQTMSSMVFCFPGVELKSVP
LALKHVKLLKDEDTVVERIRKNLETREVNVAVFVIPFSTSEHPKIRGKKQFTHYPKRSIS
SSCLATLANSITPKENIYSASKELYRLDGKLTVLGPDFPVKFIWIGRCGRNERVYC
Download sequence
Identical sequences E3LX35
CRE02995 31234.CRE02995 XP_003111524.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]