SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE03461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE03461
Domain Number 1 Region: 464-899
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.78e-121
Family Reverse transcriptase 0.0000983
Further Details:      
 
Domain Number 2 Region: 1079-1235
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.61e-40
Family Retroviral integrase, catalytic domain 0.0093
Further Details:      
 
Domain Number 3 Region: 331-424
Classification Level Classification E-value
Superfamily Acid proteases 1.72e-16
Family Retroviral protease (retropepsin) 0.0085
Further Details:      
 
Domain Number 4 Region: 264-308
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000293
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE03461
Sequence length 1398
Comment (Caenorhabditis remanei)
Sequence
MADSPTQHGDQDTQAAILKLTEQVMNLMTIFTQNQTPPAAASSTTVASTFDSSKLMDTIS
SRIPMFTYVPEEEKTFEGWFNRYEEIVTKDGAQLADDTKTRVILAKLSPTDYAHYTNRIL
PKVPNELSFNETIGVLKTTFKSTTSVFRKRQEFLRSEYSGGSLEEYTGSILRGYTSSEFK
KMSDDQLCCLIWINGMKDSSYQDIRTRALQVLEQKPRITLLEMEAEVKRVLDIRADSKAV
APSNQSPEVQAVQKKPQNQHNQNKTEKQPPSPCYRCGGNHWSKDCKYQTATCRTCNKTGH
LAKSCRSKPRDHPKVSHKVKTVFVGVAATHGSTRIYKSVTINGKPIKMLLDTGADVTLVN
LTDWKRLGRPKLEPPSIRVRAANNQVITVKGSFNCNFELNGVRATGTAHVTETNTLLGID
WVAQDQTFWKLLHDAPTINSASTSSGSACSYLDGLRDGLKVDLSSEYPDVFQSGLGLCKK
MRAKLKLKPNAKPVFRKSRPVPYASLEALSNEIDRLEATGVLKSLDHSDWAAPVVAVTKK
NGSIRLCSDFSTGLNDAIEAHQHPLPTADDIFAKLNGGKFFSQIDLADAYLQIEVDDDSK
KLLVINTHKGLFHYNKLPFGVKAAPGIFQQVMDTMLAGLDGVACYLDDIIVTGCSIEEHN
QRVKKVIERIASFGFRMRLEKCSFLMPEIQFLGFVINEQGRKPDPQKIADIKAMPAPKNA
IEVRSFLGLIQFYGTFVRDLHRLRPPLDKLTNKDVEFKWDTECQHAFDQVKEMLQSDLLL
THYNPKVPIIVAADASQYGIGATISHRFPDGKEKAIYHVSKALNKAQRNYSQIEKEAFGL
VTAVTKFHKFVHGRRFTLRTDHKPLLSIFGEKKGVPIYTANRLQRWATILMNYNFSIEYI
NTKDFGQVDALSRLISDQMQQREETEEVVIAHIEGDIICSLDRVCDQLPVTVDIIRSETH
RDKLLMKVMECIRSGKWPVLDKAAPIWLFQQRQTELSIVQECVMIGERIVLPTSLKTKVL
LMLHRGHPGIVRMKKLARSYVYWPAMDKDIENLVKCCDPCAGAAKNPVKDVLHSWPCSTK
PWNRVHADYCGPLQGIYYLVIVDSYSKWPEVYATKSITTSATIHIFRQVFAQFGNPEILV
TDNGSQFSSKQLEQFCKLNGITHVRSPPFHPQSNGQAERFVDTLKRALQKLRGEGNSDSA
VTTFLQTYRATPCAASPNGLSPAENFLNRKLRTELDLLLPMDPNVGDRNRKMEEQFNNQH
GARPRHFVVNQKVYVKDYRSPKATWIPGIIIRKLGGTIYDVRADDKTWRRHANQLRIRSS
ATACQEAADLLEMPIRFTQEPITEPVMPPSPTTPPLPTNPIVPSQPASPSSPPLRRSSRN
VHPPKRLCMDPKKKSYRR
Download sequence
Identical sequences E3NGN3
XP_003092417.1.11157 CRE03461 31234.CRE03461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]