SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE03622 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE03622
Domain Number 1 Region: 480-507
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000349
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE03622
Sequence length 553
Comment (Caenorhabditis remanei)
Sequence
MSDKTASKQSTSKVDDDRMIVVETQMSVKERRKKVKNSTKLIASSVKVEDETRLQLGELT
TKRSETEVDAILEPMKSFHRELLEKFEEIGGDKWPRSVIRVMREFELESVEELREACAKA
AEGEEAEWSVGKVNLELQQVQYEMKVLTECWNEERERLGEQIRKVQEEKEVAEIQVSKLE
KALKQLRKTLERQERRPNGLWDETQGSRSWCERVENWDIERNDERSRKKGGEDAFSRKTL
SHSGSSEVNDMMQCMNRMLKSSALPEPKTFDGTGEFKEFKRAFLLKYNHVTENDYELVAI
LEEKFLKGAAKSLFKTLPKRFERSIQSLFEEFEQKLRKRQGDSKIEALNEFEGLEKRSDQ
KMWEYLVEVEKWSRKAFPEVKQETLSQMRTTKLMKAVRGDETLHKMLIMKRFELSLEEQY
DHLKDIVLQQENEQRRGNGQKSGYSEGWKGRKDSQWKEREEERPKAENDGEKGETVADRG
SGEKQYWREQRCFSCGGVGHLARQCSPKPVQSVEVRGKGEGVGIVAVETVMMLGQERKMV
IDSGXXXXILIMQ
Download sequence
Identical sequences E3LXB2
31234.CRE03622 XP_003111432.1.11157 CRE03622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]