SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE03677 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE03677
Domain Number 1 Region: 287-320
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000254
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE03677
Sequence length 396
Comment (Caenorhabditis remanei)
Sequence
MHRAKKKQSRRSNADSSPEHSGSKVSLSNDKTVSKWVAGGAGSMTCATVRSALSTVHFSI
NQLSEHVGKTQFTPRGVWEVQEVETVQEGEHEPRREKVGQDLRDVWSDEVTQPLQEVGQL
VPMFPQQPRFNNSHRDHYYSEAGHLTIVTTQWLGKTIKKYAEAVQAEIDLTEKVESFRRD
LRSRENLIEVLKLKLISLLEQKYGPDQIEQLPELLLVKELLRLGEETEGQDRHRRLSTSS
VASYHTSLVREDQEDNADPVSKIDSWAKEMESVHNQEESPSKELKCSGNSKKSTPKRKNT
CFFCGKEGHFVKECREKAKLLATTPARRQGTAPRFPSKKEVNNFASKLLASAHSLVATIP
RPATVIAAVAVSAVSLVANALSPPPPQRHSTTTRTV
Download sequence
Identical sequences E3LXM7
XP_003111293.1.11157 CRE03677 31234.CRE03677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]