SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE03878 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE03878
Domain Number 1 Region: 300-399
Classification Level Classification E-value
Superfamily Acid proteases 0.0000713
Family Retroviral protease (retropepsin) 0.019
Further Details:      
 
Weak hits

Sequence:  31234.CRE03878
Domain Number - Region: 239-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000272
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Domain Number - Region: 54-165
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0942
Family IMD domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE03878
Sequence length 697
Comment (Caenorhabditis remanei)
Sequence
MSFSTERIKERSSSVTSSEKSWAVQMNEVRLKERRKLVKGFTDFLESSGRMESDMYEALK
AACKGNERQSEVLVEPVKKYCQELRERFEELGGERWPLEIIGVMRENGVETVEELRELCE
KGVEMVPGGIVENANKAQDELALLQDAWNEERETLFRELNKLKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKQENEPKKAGQARDTKEVPVPSRLEVVRKWSPTDSDDEFSMHGKR
GDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVKNAGVETVEMVEML
GQRRRVVIDSGAVVSVISTSAYERLKAGCRDWEKEVEVFGKPAFTVLNASNSKMRVRGQI
KIPMVVRGRKVRVVFQLVENWVEKILIGTNAFESIGVELKWKDPYGLVNAEENSAEVQFI
GGEKKLERLGGKLRKVPTEVSEIQCKTVAVRGERGRSSSTGDVGEVFKSEGEKERKRVKI
RASVAVIGPRLEARGPGVLEYRNKTITGWTQKFDWEEVKEAVVLVEYTDKEDENSKIVEF
VKSVAKEVEKVWMMPRSLQCEFGDVDNVAKQWKEWLKTSANVEVVDPLMPVGNHKTPLIL
EKWHRKSLDGLQKYLHNALPSHSVRCQWEKNTDRRPQSGLKKDLGKGCPIAERRGKWLRR
SSTFSKPIGREETKGEKARGIWTTQATSKADVKLNFP
Download sequence
Identical sequences E3LXL6
XP_003111415.1.11157 CRE03878 31234.CRE03878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]