SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE04256 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE04256
Domain Number 1 Region: 300-397
Classification Level Classification E-value
Superfamily Acid proteases 0.0000563
Family Retroviral protease (retropepsin) 0.023
Further Details:      
 
Weak hits

Sequence:  31234.CRE04256
Domain Number - Region: 240-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000147
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Domain Number - Region: 52-165
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0068
Family IMD domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE04256
Sequence length 410
Comment (Caenorhabditis remanei)
Sequence
MSFSTERTKKRSSSVTSSEKSWAVQMNEVRLKERRKLVKGFTDFLESSGRMESDMYEALK
AAFKGNERQSEVLVEPVKKYCHKLRERFEELGGERWPLEIIGVMRENGVETVEELRELCE
KGVEMVPGGIVENAKKARDELALLQDAWNEERETLFRELNKLKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKQESEPKKAGQVRDTKEVPVPSRLEVVRKWSPRDSDDEFSMHGRR
GDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVKNAGVETVEMVEML
GQRRRVVIDSGAVVSVISTTAYERLKAGCRDWEKEVEVFGKPTFTVLNASNSKMRVRGQI
KIPMVVRGRKVRVVFQLVENWVEKILIGTNAFESIGVEPKWKHPYGLGIA
Download sequence
Identical sequences E3N680
XP_003096094.1.11157 31234.CRE04256 CRE04256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]