SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE04387 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE04387
Domain Number 1 Region: 590-647
Classification Level Classification E-value
Superfamily Acid proteases 0.00000221
Family Retroviral protease (retropepsin) 0.033
Further Details:      
 
Weak hits

Sequence:  31234.CRE04387
Domain Number - Region: 111-158
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0523
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE04387
Sequence length 1312
Comment (Caenorhabditis remanei)
Sequence
MSSVTSRSRHSSVSTEMSYRGDENNSKSPRRSMSVNSAKDVFRDAEAQSFDAGPSAITNG
SGRALSFPQIFEPRPDAAPIVHQTLGALLSGAVLPNVSVSAVINPAIPSEARISCPICSG
GHDDYACESPLRSLYCAKNDLCFLCTSESHKTQECPLNYLEISKNVANVSLKLGDTIGDK
IKCSGHPSSESTEQTQSVVDSEKDYRYLSYHDLVTVLPQFNADPIKYGKFARCFDRLVMT
NPRLDDLLKLSLVETKLVGKAKRFIVDLIDPRAALEATFKALQDEFEEDNYSVVNEIRGR
FENLTFHETDYKRATLELQDCKSLILQLEELKEDVSSASFVRELARKLPREAFKRLRPLN
ANGQTPTTEQVIGTFSEFLKENRFYERFCPWVQEDSSKIHEESVMIMIEGSTIPPPRKSG
KKRNSKSFSRGAGFNTDATEMPEHSNRKTTGKGKKNSSGAKNQKPLVSSVAGAETKRQEF
SNHGRIVTAPPTPSNRLGRQLAHSSKARLESEYPRSKNQNRVSEAHLKPETSLIPFGSVK
NVSNRVLDDPLSHRARSKLLPQTLVNECYEASGVKEEGDLSHLPFLALRTAKGKVVLALV
DTGASCSFLSQNCAKRLGLSPIGYRTAVIKGVSTTTTERMSMYRLSFATTGNPVEFFVSG
RSRFPETKFFRPRFGATDNDFLRERYIDPKVITKDRASNGRALEMIIGNDMLARILGNSI
RALLPSGRYVEFTPFGSIIFPAPRVIQFNPLIVPTATSRFHPANSISLVDPNPGNIDRAP
SSPQVQSGSTDNNDGSIAVRRSRQIAYLDLSLISKNHHGIRGRNFVSQQGNCNTIGLGNP
RHGTVNRQTKGEKPRMLKCTEEIFLLDASDGSSTIRYMEPRKTQEKDMMKCSLMEEHRVT
TEFQRVSVGNRVFECILKEFKICTHPEVMSHERSFDYFDSLAVYPRDNNLVLEQVELSKD
YRGFHPQYYNGKRSLLSENQFQTGISDRKEVIQKVHRVREKLDNGRTHVLKYQYLDAGRS
GASLVRDLTASPAPDAGRSGTSEEGVLRKLTSMDACRSGAPKGRKFITTDNSGQNSDEYA
ASSDPPGRRVGLKSYCFVPTIESSDTVSDVAASRSGAARGGIECLTPVPDVCRSDTPGKG
FNRVVPNLDAGRSNASTKESDESAPNLGIRQSSSHRSRVGLKSYCFVPTIESYDTVSDVV
AGRSDTTPKDTKQFNPTLGASRPGASKSKDDQKSSGSEYSQNVKLRRPRTIDDWAKIRLP
NHRVRPYQPRKAKAKLACYVSITQAAEPQTPRSVDSCLVPDHASVPLQTKMH
Download sequence
Identical sequences E3NKP1
XP_003091030.1.11157 CRE04387 31234.CRE04387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]